Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NBPF7 Peptide - middle region

NBPF7 Peptide - middle region

Product Specifications

UniProt

P0C2Y1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NBPF7 Rabbit Polyclonal Antibody (orb587559) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001041445

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELDKVQESPAPREEQKAEEKEVPEDSLEECAITYSNSHGPSDS NPPHKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Target Protein-binding moiety 6 hydrochloride
orb573301-01 100 mg

Target Protein-binding moiety 6 hydrochloride

Sign In for Pricing
View Details
Target Protein-binding moiety 6 hydrochloride
orb573301-02 250 mg

Target Protein-binding moiety 6 hydrochloride

Sign In for Pricing
View Details
Target Protein-binding moiety 6 hydrochloride
orb573301-03 1 g

Target Protein-binding moiety 6 hydrochloride

Sign In for Pricing
View Details
TCEA3 Adenovirus (Rat)
46325056 1.0 mL

TCEA3 Adenovirus (Rat)

Sign In for Pricing
View Details
CALML3 (Calmodulin-like Protein 3, CaM-like Protein, CLP, Calmodulin-related Protein NB-1) (Biotin)
124262-Biotin 100 µL

CALML3 (Calmodulin-like Protein 3, CaM-like Protein, CLP, Calmodulin-related Protein NB-1) (Biotin)

Sign In for Pricing
View Details
IRF7 Recombinant Rabbit mAb
orb2323006-01 25 µL

IRF7 Recombinant Rabbit mAb

Sign In for Pricing
View Details