ZNF671 Peptide - C-terminal region
ZNF671 Peptide - C-terminal region
Product Specifications
UniProt
Q8TAW3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF671 Rabbit Polyclonal Antibody (orb575768) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_079109
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GKAFTQRPNLIRHWKVHTGERPYVCSECGREFIRKQTLVLHQRVHAGEKL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K4136406 1.0 µg DNA
Olfr924 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
Sign In for Pricing
View Details 
AAP80954-100UG 100 µg
SLC4A4 Peptide - C-terminal region (AAP80954)
Sign In for Pricing
View Details GTR10341757 96 Well
Canine Cathepsin G Antibody (Cath G Ab) ELISA Kit
Sign In for Pricing
View Details 
GTR15147052 1 Vial
Lentiviral human GSTA1 shRNA (UAS) - Lentiviral human GSTA1 shRNA (UAS, iRFP) plasmid
Sign In for Pricing
View Details