Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF671 Peptide - C-terminal region

ZNF671 Peptide - C-terminal region

Product Specifications

UniProt

Q8TAW3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF671 Rabbit Polyclonal Antibody (orb575768) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079109

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GKAFTQRPNLIRHWKVHTGERPYVCSECGREFIRKQTLVLHQRVHAGEKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIPGBM
6892/10 10 mg

RIPGBM

Sign In for Pricing
View Details
Recombinant Mycobacterium Tuberculosis pyrG Protein (aa 1-586)
VAng-Yyj0586-inquire Inquire

Recombinant Mycobacterium Tuberculosis pyrG Protein (aa 1-586)

Sign In for Pricing
View Details
Hsa-miR-8075 agomir
HY-R02467A-01 5 nmol

Hsa-miR-8075 agomir

Sign In for Pricing
View Details
Hsa-miR-8075 agomir
HY-R02467A-02 20 nmol

Hsa-miR-8075 agomir

Sign In for Pricing
View Details
PDL-1 cpd 10
BUP07882-01 5 mg

PDL-1 cpd 10

Sign In for Pricing
View Details
PDL-1 cpd 10
BUP07882-02 10 mg

PDL-1 cpd 10

Sign In for Pricing
View Details