Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP39 Peptide - C-terminal region

USP39 Peptide - C-terminal region

Product Specifications

UniProt

B8ZZD1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with USP39 Rabbit Polyclonal Antibody (orb576850) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDETNQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPDU1 siRNA (Human)
MBS8211423-01 15 nmol

MPDU1 siRNA (Human)

Sign In for Pricing
View Details
MPDU1 siRNA (Human)
MBS8211423-02 30 nmol

MPDU1 siRNA (Human)

Sign In for Pricing
View Details
MPDU1 siRNA (Human)
MBS8211423-03 5x 30 nmol

MPDU1 siRNA (Human)

Sign In for Pricing
View Details
SLC9A3 sgRNA CRISPR Lentivector set (Human)
K2164501 3x 1.0 µg

SLC9A3 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Lentiviral human SELENOM shRNA (UAS) - Lentiviral human SELENOM shRNA (UAS, GFP) (25)
GTR15088616 1 Vial

Lentiviral human SELENOM shRNA (UAS) - Lentiviral human SELENOM shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
DNA-binding protein Ikaros
AP84624 1 mg

DNA-binding protein Ikaros

Sign In for Pricing
View Details