Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP39 Peptide - C-terminal region

USP39 Peptide - C-terminal region

Product Specifications

UniProt

B8ZZD1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with USP39 Rabbit Polyclonal Antibody (orb576850) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDETNQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SUCLG1 shRNA Plasmid
abx955802-01 150 µg

Human SUCLG1 shRNA Plasmid

Sign In for Pricing
View Details
Human SUCLG1 shRNA Plasmid
abx955802-02 300 µg

Human SUCLG1 shRNA Plasmid

Sign In for Pricing
View Details
Anti-CDK2 Antibody (R3G63)
RHD64705 100 μg

Anti-CDK2 Antibody (R3G63)

Sign In for Pricing
View Details
USH1A 3'UTR Luciferase Stable Cell Line
TU027902 1.0 mL

USH1A 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
MMP-12 (Matrix Metalloproteinase)
145527 100 µg

MMP-12 (Matrix Metalloproteinase)

Sign In for Pricing
View Details
Rabbit Polyclonal PAK2 Antibody [Alexa Fluor 532]
NBP1-76721AF532 0.1 mL

Rabbit Polyclonal PAK2 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details