Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL28 Peptide - N-terminal region

RPL28 Peptide - N-terminal region

Product Specifications

Product Name Alternative

L28

UniProt

E9PB24

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL28 Rabbit Polyclonal Antibody (orb586326) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001129607

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LIHRKTVGVEPAADGKGVVVVIKRRSGQRKPATSYVRTTINKNARATLSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR5AC2, CT (OR5AC2, Olfactory receptor 5AC2, HSA1) (Biotin) discontinued
039446-Biotin 200 µL

OR5AC2, CT (OR5AC2, Olfactory receptor 5AC2, HSA1) (Biotin) discontinued

Sign In for Pricing
View Details
Mouse Anti-Human EGFR Monoclonal antibody, clone 528
CABT-L4514-01 1 mg; 5 mg

Mouse Anti-Human EGFR Monoclonal antibody, clone 528

Sign In for Pricing
View Details
Mouse Anti-Human EGFR Monoclonal antibody, clone 528
CABT-L4514-02 1 mg

Mouse Anti-Human EGFR Monoclonal antibody, clone 528

Sign In for Pricing
View Details
Mouse Anti-Human EGFR Monoclonal antibody, clone 528
CABT-L4514-03 5mg

Mouse Anti-Human EGFR Monoclonal antibody, clone 528

Sign In for Pricing
View Details
Compound EN300-113927
orb3170344-01 1 mg

Compound EN300-113927

Sign In for Pricing
View Details
Compound EN300-113927
orb3170344-02 5 mg

Compound EN300-113927

Sign In for Pricing
View Details