Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCDC5 Peptide - N-terminal region

DCDC5 Peptide - N-terminal region

Product Specifications

UniProt

Q6ZRR9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DCDC5 Rabbit Polyclonal Antibody (orb586790) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KTTEPYAPVRLRVLQNGEKNKNRSVTILGPDISPGRKTQCTEILNLPSAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig Complement Lnhibitor ELISA Kit
MBS732527-01 48 Well

Guinea Pig Complement Lnhibitor ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Complement Lnhibitor ELISA Kit
MBS732527-02 96 Well

Guinea Pig Complement Lnhibitor ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Complement Lnhibitor ELISA Kit
MBS732527-03 5x 96 Well

Guinea Pig Complement Lnhibitor ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Complement Lnhibitor ELISA Kit
MBS732527-04 10x 96 Well

Guinea Pig Complement Lnhibitor ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Fibronectin
PHH2549-01 1 Each

Recombinant Human Fibronectin

Sign In for Pricing
View Details
Recombinant Human Fibronectin
PHH2549-02 10 µg

Recombinant Human Fibronectin

Sign In for Pricing
View Details