Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCDC5 Peptide - N-terminal region

DCDC5 Peptide - N-terminal region

Product Specifications

UniProt

Q6ZRR9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DCDC5 Rabbit Polyclonal Antibody (orb586790) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KTTEPYAPVRLRVLQNGEKNKNRSVTILGPDISPGRKTQCTEILNLPSAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atxn1 Rat shRNA Plasmid (Locus ID 25049)
TL709349 1 Kit

Atxn1 Rat shRNA Plasmid (Locus ID 25049)

Sign In for Pricing
View Details
PFKFB2 Knockout 786-O Polyclonal Cells
ARG5339 1 Million

PFKFB2 Knockout 786-O Polyclonal Cells

Sign In for Pricing
View Details
MAGEB3 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2397430 100 µL

MAGEB3 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Cd55 3'UTR Luciferase Stable Cell Line
TU201989 1.0 mL

Cd55 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse C Myc binding protein (MYCBP) ELISA Kit
GTR10355952 96 Well

Mouse C Myc binding protein (MYCBP) ELISA Kit

Sign In for Pricing
View Details
Olfr55-set siRNA/shRNA/RNAi Lentivector (Mouse)
33247094 4x 500 ng

Olfr55-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details