UBE2D4 Peptide - C-terminal region
UBE2D4 Peptide - C-terminal region
Product Specifications
UniProt
Q9UQL0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with UBE2D4 Rabbit Polyclonal Antibody (orb587072) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP15195PU-N 400 µL
Choline kinase alpha (CHKA) (C-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
AP17256PU-N 400 µL
Cathepsin E (CTSE) (Center) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
