UBE2D4 Peptide - C-terminal region
UBE2D4 Peptide - C-terminal region
Product Specifications
UniProt
Q9UQL0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with UBE2D4 Rabbit Polyclonal Antibody (orb587072) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Anti-Progesterone Receptor Antibody [JF0549]](https://cdn.genprice.uk/products/992/68dd1c8b061270361ea814e5/imageurl01/et1702-24tr.webp)
BNCB0826-100 1x 100 µL
Ep-CAM / CD326 (EGP40/826), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941982-100 1x 100 µL
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1982), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details