Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SKIDA1 Peptide - C-terminal region

SKIDA1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C10orf140, DLN-1

UniProt

E9PAX1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SKIDA1 Rabbit Polyclonal Antibody (orb326916) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997254

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ANFPCPPSLIIGRDGDLWPAYSLNTTKDSQTPHKAHPIWKWQLGGSAIPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROGDI Human Gene Knockout Kit (CRISPR)
KN402295 1 Kit

ROGDI Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SAPK4 (MAPK13) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G5]
TA505867AM 100 µL

SAPK4 (MAPK13) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G5]

Sign In for Pricing
View Details
Nuclear Matrix Protein p84 Recombinant Rabbit Monoclonal Antibody [JU53-18]
ET1706-52 100 µL

Nuclear Matrix Protein p84 Recombinant Rabbit Monoclonal Antibody [JU53-18]

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: right
CS510940 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details
FAM107B (NM_031453) Human Recombinant Protein
TP311413 20 µg

FAM107B (NM_031453) Human Recombinant Protein

Sign In for Pricing
View Details
Ubiquitin Rabbit Polyclonal Antibody
ER31212 100 µL

Ubiquitin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details