Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SKIDA1 Peptide - C-terminal region

SKIDA1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C10orf140, DLN-1

UniProt

E9PAX1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SKIDA1 Rabbit Polyclonal Antibody (orb326916) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997254

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ANFPCPPSLIIGRDGDLWPAYSLNTTKDSQTPHKAHPIWKWQLGGSAIPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerCP/Cyanine5.5 Anti-Mouse CD11c Antibody[N418]
E-AB-F0991J-01 50 Tests

PerCP/Cyanine5.5 Anti-Mouse CD11c Antibody[N418]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD11c Antibody[N418]
E-AB-F0991J-02 100 Tests

PerCP/Cyanine5.5 Anti-Mouse CD11c Antibody[N418]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD11c Antibody[N418]
E-AB-F0991J-03 2x 100 Tests

PerCP/Cyanine5.5 Anti-Mouse CD11c Antibody[N418]

Sign In for Pricing
View Details
Chloroxine
TRC-C424135-5G 5 g

Chloroxine

Sign In for Pricing
View Details
Human BCO2 activation kit by CRISPRa
GA113287 1 Kit

Human BCO2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human RAVER1 activation kit by CRISPRa
GA114898 1 Kit

Human RAVER1 activation kit by CRISPRa

Sign In for Pricing
View Details