ARHGEF37 Peptide - C-terminal region
ARHGEF37 Peptide - C-terminal region
Product Specifications
UniProt
A1IGU5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ARHGEF37 Rabbit Polyclonal Antibody (orb326929) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001001669
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VIAAYPFVARSSHEVSLQAGQPVTILEAQDKKGNPEWSLVEVNGQRGYVP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP304263M 100 µg
C7orf30 (MALSU1) (NM_138446) Human Recombinant Protein
Sign In for Pricing
View Details 
BNC042395-100 1x 100 µL
CD25/ IL2RA (Activated Lymphocyte Marker) (IL2RA/2395), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
