Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD34C Peptide - N-terminal region

ANKRD34C Peptide - N-terminal region

Product Specifications

UniProt

H3BNM1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKRD34C Rabbit Polyclonal Antibody (orb587307) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001139813

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SNDKGETALMVACITKHVDQQSISKSKMVKYLLDNRADPNIQDKSGKTAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

REG3A Antibody
ABD6825 100 µg

REG3A Antibody

Sign In for Pricing
View Details
ALX1 (3329D3a)
sc-130642 100 µg/mL

ALX1 (3329D3a)

Sign In for Pricing
View Details
PDE4D Rabbit Polyclonal Antibody
53749-01 50 µL

PDE4D Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PDE4D Rabbit Polyclonal Antibody
53749-02 100 µL

PDE4D Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human SLC25A5 siRNA
abx905020-01 15 nmol

Human SLC25A5 siRNA

Sign In for Pricing
View Details
Human SLC25A5 siRNA
abx905020-02 30 nmol

Human SLC25A5 siRNA

Sign In for Pricing
View Details