Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD34C Peptide - N-terminal region

ANKRD34C Peptide - N-terminal region

Product Specifications

UniProt

H3BNM1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKRD34C Rabbit Polyclonal Antibody (orb587307) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001139813

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SNDKGETALMVACITKHVDQQSISKSKMVKYLLDNRADPNIQDKSGKTAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbi! anti-NUCB2 Antibody, Affinity Purified
A305-345A 100 µg

Rabbi! anti-NUCB2 Antibody, Affinity Purified

Sign In for Pricing
View Details
Tmem64 sgRNA CRISPR Lentivector set (Mouse)
K3427101 3x 1.0 µg

Tmem64 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
PTP IA-2β Polyclonal Antibody
E44H03195 100 µL

PTP IA-2β Polyclonal Antibody

Sign In for Pricing
View Details
Kcnj4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7048406 1.0 µg DNA

Kcnj4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
P16INK4A Antibody
orb1318075 100 µL

P16INK4A Antibody

Sign In for Pricing
View Details
COG6 Rabbit Monoclonal Antibody
AMRe01838-01 50 µL

COG6 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details