Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD34C Peptide - N-terminal region

ANKRD34C Peptide - N-terminal region

Product Specifications

UniProt

H3BNM1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKRD34C Rabbit Polyclonal Antibody (orb587307) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001139813

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SNDKGETALMVACITKHVDQQSISKSKMVKYLLDNRADPNIQDKSGKTAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TRIM13 Antibody [mFluor Violet 610 SE]
NBP2-99022MFV610 0.1 mL

Rabbit Polyclonal TRIM13 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Anti-RTEL1 Antibody Picoband® (iFluor647 Conjugate)
A01544-1-iFluor647 100 µg

Anti-RTEL1 Antibody Picoband® (iFluor647 Conjugate)

Sign In for Pricing
View Details
Recombinant human FAP Protein, His Tag
KMP1206-01 50 µg

Recombinant human FAP Protein, His Tag

Sign In for Pricing
View Details
Recombinant human FAP Protein, His Tag
KMP1206-02 100 µg

Recombinant human FAP Protein, His Tag

Sign In for Pricing
View Details
NBPF11 Protein Vector (Human) (pPB-C-His)
PV103734 500 ng

NBPF11 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
PD-1, Recombinant, Human, aa25-167, FLAG-His-Tag (Biotin)
544354 50 µg

PD-1, Recombinant, Human, aa25-167, FLAG-His-Tag (Biotin)

Sign In for Pricing
View Details