ATP11AUN Peptide - C-terminal region
ATP11AUN Peptide - C-terminal region
Product Specifications
Product Name Alternative
SMABLO1, C13orf35
UniProt
Q6ZP68
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ATP11AUN Rabbit Polyclonal Antibody (orb326938) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_997323
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YKGRRSASGTQKQLQLPDTLSSLLCWRGAIMVYIKVTVQTDDSNKLLSLL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400040-500 1x 500 µL
CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470253-100 1x 100 µL
Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400177-500 1x 500 µL
CD50 (ICAM-3) (101-1D2), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details