Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXL2NB Peptide - N-terminal region

FOXL2NB Peptide - N-terminal region

Product Specifications

Product Name Alternative

C3orf72

UniProt

Q6ZUU3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FOXL2NB Rabbit Polyclonal Antibody (orb326940) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001035150

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PKMCLHMAVRHSKAQKTGPGILQQRQKPPAPRASGGPALLGKRRGCSEAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NPAS2 Antibody Picoband® (HRP Conjugate)
A02688-1-HRP 100 µg/Vial

Anti-NPAS2 Antibody Picoband® (HRP Conjugate)

Sign In for Pricing
View Details
Human IL-15 ELISA Kit
EKA51949 96 Tests

Human IL-15 ELISA Kit

Sign In for Pricing
View Details
Canine Selenoprotein 1 (SEP1) ELISA Kit
MBS2611204-01 48 Well

Canine Selenoprotein 1 (SEP1) ELISA Kit

Sign In for Pricing
View Details
Canine Selenoprotein 1 (SEP1) ELISA Kit
MBS2611204-02 96 Well

Canine Selenoprotein 1 (SEP1) ELISA Kit

Sign In for Pricing
View Details
Canine Selenoprotein 1 (SEP1) ELISA Kit
MBS2611204-03 5x 96 Well

Canine Selenoprotein 1 (SEP1) ELISA Kit

Sign In for Pricing
View Details
Canine Selenoprotein 1 (SEP1) ELISA Kit
MBS2611204-04 10x 96 Well

Canine Selenoprotein 1 (SEP1) ELISA Kit

Sign In for Pricing
View Details