Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXL2NB Peptide - N-terminal region

FOXL2NB Peptide - N-terminal region

Product Specifications

Product Name Alternative

C3orf72

UniProt

Q6ZUU3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FOXL2NB Rabbit Polyclonal Antibody (orb326940) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001035150

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PKMCLHMAVRHSKAQKTGPGILQQRQKPPAPRASGGPALLGKRRGCSEAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Annexin A2 (ANXA2) Antibody (FITC)
abx106560-01 20 µg

Annexin A2 (ANXA2) Antibody (FITC)

Sign In for Pricing
View Details
Annexin A2 (ANXA2) Antibody (FITC)
abx106560-02 50 µg

Annexin A2 (ANXA2) Antibody (FITC)

Sign In for Pricing
View Details
Annexin A2 (ANXA2) Antibody (FITC)
abx106560-03 100 µg

Annexin A2 (ANXA2) Antibody (FITC)

Sign In for Pricing
View Details
Annexin A2 (ANXA2) Antibody (FITC)
abx106560-04 200 µg

Annexin A2 (ANXA2) Antibody (FITC)

Sign In for Pricing
View Details
Annexin A2 (ANXA2) Antibody (FITC)
abx106560-05 1 mg

Annexin A2 (ANXA2) Antibody (FITC)

Sign In for Pricing
View Details
FAM82A1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0732206 1.0 µg DNA

FAM82A1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details