C16orf90 Peptide - N-terminal region
C16orf90 Peptide - N-terminal region
Product Specifications
UniProt
A8MZG2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C16orf90 Rabbit Polyclonal Antibody (orb326949) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001073993
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: APPNIYEGGLGSPQPQCPSAQGSKPKNFRLRHLRGLGLYLESHPPPTGQC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400977-500 1x 500 µL
TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680050-500 1x 500 µL
IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC550525-100 1x 100 µL
CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details