Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZAR1L Peptide - C-terminal region

ZAR1L Peptide - C-terminal region

Product Specifications

Product Name Alternative

ZAR2

UniProt

A6NP61

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZAR1L Rabbit Polyclonal Antibody (orb587327) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001130043

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPGQLEESGEKDAPCPQETKSKQVPGDAASEPLRRPNFQFLEPKYGYFHC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse CD276/B7-H3 Antibody (MJ18), APC
FMJ04013 100 Tests

Anti-Mouse CD276/B7-H3 Antibody (MJ18), APC

Sign In for Pricing
View Details
Liver X Receptor Alpha (LXRa), Recombinant, Mouse, His-Tag
056467-01 10 µg

Liver X Receptor Alpha (LXRa), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
Liver X Receptor Alpha (LXRa), Recombinant, Mouse, His-Tag
056467-02 50 µg

Liver X Receptor Alpha (LXRa), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
Liver X Receptor Alpha (LXRa), Recombinant, Mouse, His-Tag
056467-03 100 µg

Liver X Receptor Alpha (LXRa), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
Liver X Receptor Alpha (LXRa), Recombinant, Mouse, His-Tag
056467-04 200 µg

Liver X Receptor Alpha (LXRa), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
Recombinant Human CD45/PTPRC Protein, N-His
orb2969375-01 50 µg

Recombinant Human CD45/PTPRC Protein, N-His

Sign In for Pricing
View Details