Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF5A Peptide - N-terminal region

EIF5A Peptide - N-terminal region

Product Specifications

UniProt

P63241

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF5A Rabbit Polyclonal Antibody (orb331387) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse A Disintegrin And Metalloprotease 8 ELISA Kit
IMSADAM8KT 1 Each

Mouse A Disintegrin And Metalloprotease 8 ELISA Kit

Sign In for Pricing
View Details
Human INHBE Pre-designed siRNA Set B
SI007669B 1 Each

Human INHBE Pre-designed siRNA Set B

Sign In for Pricing
View Details
Rabbit LARP1 Antibody
orb1527240-01 10 µL

Rabbit LARP1 Antibody

Sign In for Pricing
View Details
Rabbit LARP1 Antibody
orb1527240-02 100 µL

Rabbit LARP1 Antibody

Sign In for Pricing
View Details
Rat Serine/threonine-protein kinase PLK2 (PLK2) ELISA Kit
MBS2805885-01 48 Tests

Rat Serine/threonine-protein kinase PLK2 (PLK2) ELISA Kit

Sign In for Pricing
View Details
Rat Serine/threonine-protein kinase PLK2 (PLK2) ELISA Kit
MBS2805885-02 96 Tests

Rat Serine/threonine-protein kinase PLK2 (PLK2) ELISA Kit

Sign In for Pricing
View Details