EIF5A Peptide - N-terminal region
EIF5A Peptide - N-terminal region
Product Specifications
UniProt
P63241
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EIF5A Rabbit Polyclonal Antibody (orb331387) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS8105342-01 0.1 mL
Recombinant Anti-CUEDC2 Antibody, Rabbit Monoclonal
Sign In for Pricing
View Details MBS8105342-02 5x 0.1 mL
Recombinant Anti-CUEDC2 Antibody, Rabbit Monoclonal
Sign In for Pricing
View Details ![4-Fluoro-2-[ (1-phenyl-1H-pyrazol-4-yl) (2-phenylhydrazin-1-ylidene) methyl]phenol](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
GQB49256-01 250 mg
4-Fluoro-2-[ (1-phenyl-1H-pyrazol-4-yl) (2-phenylhydrazin-1-ylidene) methyl]phenol
Sign In for Pricing
View Details GQB49256-02 2.5 g
4-Fluoro-2-[ (1-phenyl-1H-pyrazol-4-yl) (2-phenylhydrazin-1-ylidene) methyl]phenol
Sign In for Pricing
View Details GTR15355060 1 Vial
Lentiviral human TXN sgRNA gene knockout kit - Lentiviral human TXN sgRNA gene knockout kit (plasmid)
Sign In for Pricing
View Details 