Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EEF2KMT Peptide - C-terminal region

EEF2KMT Peptide - C-terminal region

Product Specifications

Product Name Alternative

SB153, FAM86A, eEF2-KMT

UniProt

K7ES84

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EEF2KMT Rabbit Polyclonal Antibody (orb587395) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001275958.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CPEAIMSLVGVLRRLAACREHQRAPEVYVAFTVRNPETCQLFTTELGRAG

More Discoveries

Explore Other Products

Browse additional items from our catalog

VN1R18P ORF Vector (Human) (pORF)
ORF035702 1.0 µg DNA

VN1R18P ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
c-Jun (Phospho-Ser243) Rabbit pAb
MBS8541476-01 0.1 mL

c-Jun (Phospho-Ser243) Rabbit pAb

Sign In for Pricing
View Details
c-Jun (Phospho-Ser243) Rabbit pAb
MBS8541476-02 0.1 mL (AF405L)

c-Jun (Phospho-Ser243) Rabbit pAb

Sign In for Pricing
View Details
c-Jun (Phospho-Ser243) Rabbit pAb
MBS8541476-03 0.1 mL (AF405S)

c-Jun (Phospho-Ser243) Rabbit pAb

Sign In for Pricing
View Details
c-Jun (Phospho-Ser243) Rabbit pAb
MBS8541476-04 0.1 mL (AF610)

c-Jun (Phospho-Ser243) Rabbit pAb

Sign In for Pricing
View Details
c-Jun (Phospho-Ser243) Rabbit pAb
MBS8541476-05 0.1 mL (AF635)

c-Jun (Phospho-Ser243) Rabbit pAb

Sign In for Pricing
View Details