HIST1H2AE Peptide - N-terminal region
HIST1H2AE Peptide - N-terminal region
Product Specifications
Product Name Alternative
H2A.1, H2A.2, H2A/a, H2AFA
UniProt
P04908
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HIST1H2AE Rabbit Polyclonal Antibody (orb327005) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_066390
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC422113 20 µg
RBM35A (ESRP1) (NM_001034915) Human Over-expression Lysate
Sign In for Pricing
View Details 
#20916-250uL 1x 250 µL
CF®505 F (ab') 2 fragment of Goat Anti-Mouse IgG (H+L), 2 mg/mL
Sign In for Pricing
View Details 
