Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IKBIP Peptide - N-terminal region

IKBIP Peptide - N-terminal region

Product Specifications

UniProt

Q70UQ0

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IKBIP Rabbit Polyclonal Antibody (orb587460) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MSEVKSRKKSGPKGAPAAEPGKRSEGGKTPVARSSGGGGWADPRTCLSLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS514915 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
UBE2G2 Mouse Monoclonal Antibody [Clone:9F2]
E45M13063 100 µg

UBE2G2 Mouse Monoclonal Antibody [Clone:9F2]

Sign In for Pricing
View Details
PE Hamster anti-mouse CD103
E16FMP103-200U 200 µg

PE Hamster anti-mouse CD103

Sign In for Pricing
View Details
PCMV-HA-Mns1 Plasmid
PVT79289 2 µg

PCMV-HA-Mns1 Plasmid

Sign In for Pricing
View Details
MERTK (NM_006343) Human Recombinant Protein
TP700174 20 µg

MERTK (NM_006343) Human Recombinant Protein

Sign In for Pricing
View Details
DHX34
560374-01 50 µg

DHX34

Sign In for Pricing
View Details