Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IKBIP Peptide - N-terminal region

IKBIP Peptide - N-terminal region

Product Specifications

UniProt

Q70UQ0

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IKBIP Rabbit Polyclonal Antibody (orb587460) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MSEVKSRKKSGPKGAPAAEPGKRSEGGKTPVARSSGGGGWADPRTCLSLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calneuron 1 (CALN1) Human Over-expression Lysate
orb1363230 20 µg

Calneuron 1 (CALN1) Human Over-expression Lysate

Sign In for Pricing
View Details
Ac-Endothelin-1 (16-21), human [Ac-His-Leu-Asp-Ile-Ile-Trp (MW: 837.98) ]
SP-88402-5 5 mg

Ac-Endothelin-1 (16-21), human [Ac-His-Leu-Asp-Ile-Ile-Trp (MW: 837.98) ]

Sign In for Pricing
View Details
Recombinant Cytokeratin 9 Rabbit mAb
E38MA4311 100 µL

Recombinant Cytokeratin 9 Rabbit mAb

Sign In for Pricing
View Details
Sheep Prolactin-releasing peptide ELISA kit
GTR10403701 96 Well

Sheep Prolactin-releasing peptide ELISA kit

Sign In for Pricing
View Details
2-Bromo-2',6'-difluoroacetophenone
415741-01 100 mg

2-Bromo-2',6'-difluoroacetophenone

Sign In for Pricing
View Details
2-Bromo-2',6'-difluoroacetophenone
415741-02 250 mg

2-Bromo-2',6'-difluoroacetophenone

Sign In for Pricing
View Details