INTS10 Peptide - N-terminal region
INTS10 Peptide - N-terminal region
Product Specifications
Product Name Alternative
C8orf35, INT10
UniProt
Q9NVR2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with INTS10 Rabbit Polyclonal Antibody (orb587467) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060612
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NAERTATAGRLLYDMFVNFPDQPVVWREISIITSALRNDSQDKQTQFLRS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![ACTH (POMC) (1-24) Mouse Monoclonal Antibody [Clone ID: AH26]](https://cdn.genprice.uk/products/937/68dd189e061270361e8fd3a6/imageurl/am32828pu-t.webp)
AM32828PU-T 20 µg
ACTH (POMC) (1-24) Mouse Monoclonal Antibody [Clone ID: AH26]
Sign In for Pricing
View Details 
PDEH100607-01 20 µg
Recombinant Human CCL23/MPIF-1 Protein (Sumo Tag)
Sign In for Pricing
View Details