INTS10 Peptide - N-terminal region
INTS10 Peptide - N-terminal region
Product Specifications
Product Name Alternative
C8orf35, INT10
UniProt
Q9NVR2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with INTS10 Rabbit Polyclonal Antibody (orb587467) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060612
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NAERTATAGRLLYDMFVNFPDQPVVWREISIITSALRNDSQDKQTQFLRS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![APC Anti-Mouse TER-119 Antibody[TER-119]](https://cdn.genprice.uk/products/763/68dd14a5061270361e7d1687/imageurl/e-ab-f1125e.webp)
E-AB-F1125E-03 2x 100 Tests
APC Anti-Mouse TER-119 Antibody[TER-119]
Sign In for Pricing
View Details ![LKB1 (STK11) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B2]](https://cdn.genprice.uk/products/937/6868c3a0994c49e6dc3fb7f0/imageurl/ta802379bm.webp)
TA802379BM 100 µL
LKB1 (STK11) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B2]
Sign In for Pricing
View Details 