Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IQCF6 Peptide - C-terminal region

IQCF6 Peptide - C-terminal region

Product Specifications

UniProt

A8MYZ5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IQCF6 Rabbit Polyclonal Antibody (orb587470) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VQAQVRMWQARRRFLQARQAACIIQSHWRWHASQTRGLIRGHYEVRASRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Laminin subunit beta-2 ELISA Kit
MBS2886460-01 48 Well

Rat Laminin subunit beta-2 ELISA Kit

Sign In for Pricing
View Details
Rat Laminin subunit beta-2 ELISA Kit
MBS2886460-02 96 Well

Rat Laminin subunit beta-2 ELISA Kit

Sign In for Pricing
View Details
Rat Laminin subunit beta-2 ELISA Kit
MBS2886460-03 5x 96 Well

Rat Laminin subunit beta-2 ELISA Kit

Sign In for Pricing
View Details
Rat Laminin subunit beta-2 ELISA Kit
MBS2886460-04 10x 96 Well

Rat Laminin subunit beta-2 ELISA Kit

Sign In for Pricing
View Details
Eyes absent homolog 2 (EYA2) Bovine ELISA Kit
D3069 96 Tests

Eyes absent homolog 2 (EYA2) Bovine ELISA Kit

Sign In for Pricing
View Details
Human BAFF AssayLite™ Antibody (APC Conjugate)
32834-05161 5x 30 µg

Human BAFF AssayLite™ Antibody (APC Conjugate)

Sign In for Pricing
View Details