Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IQCF6 Peptide - C-terminal region

IQCF6 Peptide - C-terminal region

Product Specifications

UniProt

A8MYZ5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IQCF6 Rabbit Polyclonal Antibody (orb587470) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VQAQVRMWQARRRFLQARQAACIIQSHWRWHASQTRGLIRGHYEVRASRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Sult2a3 shRNA (UAS) - Lentiviral mouse Sult2a3 shRNA (UAS, GFP) (100)
GTR15193209 1 Vial

Lentiviral mouse Sult2a3 shRNA (UAS) - Lentiviral mouse Sult2a3 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Lentiviral mouse Prr29 shRNA (UAS) - Lentiviral mouse Prr29 shRNA (UAS, GFP) plasmid
GTR15268834 1 Vial

Lentiviral mouse Prr29 shRNA (UAS) - Lentiviral mouse Prr29 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Anti-Human CD178/FASLG/TNFSF6 Antibody (NOK2/NOK-2), APC
HW497137-01 1 Each

Anti-Human CD178/FASLG/TNFSF6 Antibody (NOK2/NOK-2), APC

Sign In for Pricing
View Details
Anti-Human CD178/FASLG/TNFSF6 Antibody (NOK2/NOK-2), APC
HW497137-02 100 Tests

Anti-Human CD178/FASLG/TNFSF6 Antibody (NOK2/NOK-2), APC

Sign In for Pricing
View Details
Positive electrode for FMMS10
FMMS10-PE 1 Unit

Positive electrode for FMMS10

Sign In for Pricing
View Details
Fgd5-set siRNA/shRNA/RNAi Lentivector (Mouse)
20480094 4x 500 ng

Fgd5-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details