MSANTD4 Peptide - N-terminal region
MSANTD4 Peptide - N-terminal region
Product Specifications
Product Name Alternative
KIAA1826
UniProt
Q8NCY6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MSANTD4 Rabbit Polyclonal Antibody (orb327013) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_115800
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QLNTTINVMKRMAWEEIAQCVNAVGEGEQRTGTEVKRRYLDWRALMKRKR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942266-100 1x 100 µL
Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402422-100 1x 100 µL
BOB.1 (B-Cell Marker) (BOB1/2422), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
KN210750LP 1 Kit
galectin 9 (LGALS9) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details 
BNC881877-100 1x 100 µL
Cytokeratin, Multi (Epithelial Marker) (KRT/1877R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![TRIM29 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5C11]](https://cdn.genprice.uk/products/937/6868c40b994c49e6dc4058b5/imageurl/ta812274bm.webp)
TA812274BM 100 µL
TRIM29 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5C11]
Sign In for Pricing
View Details 
#30126-T 1 Kit
ExoBriteTM 640/660 WGA EV Staining Kit, 100 labelings
Sign In for Pricing
View Details