Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSANTD4 Peptide - N-terminal region

MSANTD4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KIAA1826

UniProt

Q8NCY6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MSANTD4 Rabbit Polyclonal Antibody (orb327013) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115800

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QLNTTINVMKRMAWEEIAQCVNAVGEGEQRTGTEVKRRYLDWRALMKRKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NNOS (Ab-852) Antibody
8B0527-AAT 50 µg

NNOS (Ab-852) Antibody

Sign In for Pricing
View Details
Mouse Vti1a activation kit by CRISPRa
GA205586 1 Kit

Mouse Vti1a activation kit by CRISPRa

Sign In for Pricing
View Details
Hacd3 Mouse Gene Knockout Kit (CRISPR)
KN514202 1 Kit

Hacd3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS803247 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
Alkaline Phosphatase (Placental) / PLAP (Germ Cell Tumor Marker) (ALPP/2899R), CF640R conjugate, 0.1mg/mL
BNC402899-500 1x 500 µL

Alkaline Phosphatase (Placental) / PLAP (Germ Cell Tumor Marker) (ALPP/2899R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR561320 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details