Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT26 Peptide - C-terminal region

KRT26 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CK26, K25IRS2, K26, KRT25B

UniProt

Q7Z3Y9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT26 Rabbit Polyclonal Antibody (orb587502) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_853517

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IDIYCNLLDGEERKSKSTCYKSKGYRPVNSGNQAKDSTEETIVKTVVEEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Phosphono Pyruvic Acid Cyclohexylamine Salt
TRC-P358700-1MG 1 mg

3-Phosphono Pyruvic Acid Cyclohexylamine Salt

Sign In for Pricing
View Details
CHD4 Antibody
KC-1398-01 50 μL

CHD4 Antibody

Sign In for Pricing
View Details
CHD4 Antibody
KC-1398-02 100 µL

CHD4 Antibody

Sign In for Pricing
View Details
CHD4 Antibody
KC-1398-03 1 mL

CHD4 Antibody

Sign In for Pricing
View Details
PKC beta 1 (PRKCB) Rabbit Polyclonal Antibody
AP09394PU-S 25 µL

PKC beta 1 (PRKCB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Caspase-3 Polyclonal Antibody
E-AB-63510-01 60 µL

Caspase-3 Polyclonal Antibody

Sign In for Pricing
View Details