KRT26 Peptide - C-terminal region
KRT26 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CK26, K25IRS2, K26, KRT25B
UniProt
Q7Z3Y9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KRT26 Rabbit Polyclonal Antibody (orb587502) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_853517
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IDIYCNLLDGEERKSKSTCYKSKGYRPVNSGNQAKDSTEETIVKTVVEEL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471830-100 1x 100 µL
CD68 (Macrophage Marker) (LAMP4/1830), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![CSN7b Recombinant Rabbit Monoclonal Antibody [PSH06-84]](https://cdn.genprice.uk/products/992/68dd1c8e061270361ea8232f/imageurl/ha722758.webp)
HA722758 100 µL
CSN7b Recombinant Rabbit Monoclonal Antibody [PSH06-84]
Sign In for Pricing
View Details 
FAF-002-2 2 mL
FITC Conjugated Goat Affinity Purified Antibody to Human IgA
Sign In for Pricing
View Details 
![Human Kappa Light Chain Mouse Monoclonal Antibody [Clone ID: TB28-2]](https://cdn.genprice.uk/products/937/68dd189c061270361e8fca43/imageurl/am26044rp-n.webp)
AM26044RP-N 100 Tests
Human Kappa Light Chain Mouse Monoclonal Antibody [Clone ID: TB28-2]
Sign In for Pricing
View Details ![GTF2F2 Recombinant Rabbit Monoclonal Antibody [JE56-15]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea80e74/imageurl/et7111-08.webp)
ET7111-08 100 µL
GTF2F2 Recombinant Rabbit Monoclonal Antibody [JE56-15]
Sign In for Pricing
View Details