Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT39 Peptide - N-terminal region

KRT39 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CK-39, K39, KA35

UniProt

Q6A163

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT39 Rabbit Polyclonal Antibody (orb327015) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_998821

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NFNARFSLDDCSWYGEGINSNEKETMQILNERLANYLQKVRMLERENAEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Semaphorin-3G (Sema3g)
orb1785121-01 20 µg

Recombinant Mouse Semaphorin-3G (Sema3g)

Sign In for Pricing
View Details
Recombinant Mouse Semaphorin-3G (Sema3g)
orb1785121-02 100 µg

Recombinant Mouse Semaphorin-3G (Sema3g)

Sign In for Pricing
View Details
Recombinant Mouse Semaphorin-3G (Sema3g)
orb1785121-03 1 mg

Recombinant Mouse Semaphorin-3G (Sema3g)

Sign In for Pricing
View Details
RPLP0 (NM_053275) Human Tagged ORF Clone
RG201445 10 µg

RPLP0 (NM_053275) Human Tagged ORF Clone

Sign In for Pricing
View Details
Phospho-CDKN1A (Thr145) Antibody
MBS7132885-01 0.1 mL

Phospho-CDKN1A (Thr145) Antibody

Sign In for Pricing
View Details
Phospho-CDKN1A (Thr145) Antibody
MBS7132885-02 5x 0.1 mL

Phospho-CDKN1A (Thr145) Antibody

Sign In for Pricing
View Details