Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT39 Peptide - N-terminal region

KRT39 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CK-39, K39, KA35

UniProt

Q6A163

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT39 Rabbit Polyclonal Antibody (orb327015) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_998821

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NFNARFSLDDCSWYGEGINSNEKETMQILNERLANYLQKVRMLERENAEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE9A (NM_001001578) Human Over-expression Lysate
LY424395 100 µg

PDE9A (NM_001001578) Human Over-expression Lysate

Sign In for Pricing
View Details
Bovine Nucleolar protein 56, NOP56 ELISA KIT
ELI-16702b 96 Tests

Bovine Nucleolar protein 56, NOP56 ELISA KIT

Sign In for Pricing
View Details
Human CD71/TFRC Antibody , PE
E55A10081 50 Tests

Human CD71/TFRC Antibody , PE

Sign In for Pricing
View Details
Modulator of Apoptosis 1 (MOAP1) Human ELISA Kit
F0725 96 Tests

Modulator of Apoptosis 1 (MOAP1) Human ELISA Kit

Sign In for Pricing
View Details
T3 (TrIIodothyronine) Human ELISA Kit
H4440 96 Tests

T3 (TrIIodothyronine) Human ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal TCF-12/HTF4 Antibody [DyLight 650]
NBP1-76304C 0.1 mL

Rabbit Polyclonal TCF-12/HTF4 Antibody [DyLight 650]

Sign In for Pricing
View Details