Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LMAN1L Peptide - C-terminal region

LMAN1L Peptide - C-terminal region

Product Specifications

Product Name Alternative

ERGIC-53L, ERGL

UniProt

Q9HAT1

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LMAN1L Rabbit Polyclonal Antibody (orb587517) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_068591

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLSKQLAQAERQWKKQLGPPGQARPDGGWALDASCQIPSTPGRGGHLSMS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD200 (CD200 Antigen, MOX1, MOX2, MRC, My033, OX2, OX-2 Membrane Glycoprotein, OX2G) (AP)
MBS6247532-01 0.1 mL

CD200 (CD200 Antigen, MOX1, MOX2, MRC, My033, OX2, OX-2 Membrane Glycoprotein, OX2G) (AP)

Sign In for Pricing
View Details
CD200 (CD200 Antigen, MOX1, MOX2, MRC, My033, OX2, OX-2 Membrane Glycoprotein, OX2G) (AP)
MBS6247532-02 5x 0.1 mL

CD200 (CD200 Antigen, MOX1, MOX2, MRC, My033, OX2, OX-2 Membrane Glycoprotein, OX2G) (AP)

Sign In for Pricing
View Details
HP 293 Cell Lysate
401429 0.1 mg

HP 293 Cell Lysate

Sign In for Pricing
View Details
Human PD-1 ELISA Kit
EK5437 96 Tests

Human PD-1 ELISA Kit

Sign In for Pricing
View Details
ATXN10 (NM_001167621) Human Tagged ORF Clone
RG230029 10 µg

ATXN10 (NM_001167621) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human EFNA1 Protein, N-His
HB164012-01 50 µg

Recombinant Human EFNA1 Protein, N-His

Sign In for Pricing
View Details