Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LMAN1L Peptide - C-terminal region

LMAN1L Peptide - C-terminal region

Product Specifications

Product Name Alternative

ERGIC-53L, ERGL

UniProt

Q9HAT1

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LMAN1L Rabbit Polyclonal Antibody (orb587517) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_068591

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLSKQLAQAERQWKKQLGPPGQARPDGGWALDASCQIPSTPGRGGHLSMS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp828 Protein Vector (Mouse) (pPB-N-His)
PV250351 500 ng

Zfp828 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
CBR3 Polyclonal Antibody
RD218587A-01 20 µL

CBR3 Polyclonal Antibody

Sign In for Pricing
View Details
CBR3 Polyclonal Antibody
RD218587A-02 60 μL

CBR3 Polyclonal Antibody

Sign In for Pricing
View Details
CBR3 Polyclonal Antibody
RD218587A-03 120 μL

CBR3 Polyclonal Antibody

Sign In for Pricing
View Details
CBR3 Polyclonal Antibody
RD218587A-04 200 µL

CBR3 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-XRN1 Antibody
MBS8325211-01 0.03 mL

Anti-XRN1 Antibody

Sign In for Pricing
View Details