LMOD3 Peptide - N-terminal region
LMOD3 Peptide - N-terminal region
Product Specifications
UniProt
Q0VAK6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LMOD3 Rabbit Polyclonal Antibody (orb327021) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VKSEEKTQEEHEEIEKRNKNMAQYLKEKLNNEIVANKRESKGSSNIQETD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUB1991-500 1x 500 µL
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1991), 0.2mg/mL
Sign In for Pricing
View Details ![BNIPL Mouse Monoclonal Antibody [Clone ID: OTI9C1]](https://cdn.genprice.uk/products/937/68dd18ba061270361e908555/imageurl/cf809280.webp)
