LMOD3 Peptide - N-terminal region
LMOD3 Peptide - N-terminal region
Product Specifications
UniProt
Q0VAK6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LMOD3 Rabbit Polyclonal Antibody (orb327021) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VKSEEKTQEEHEEIEKRNKNMAQYLKEKLNNEIVANKRESKGSSNIQETD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP12640PU-N 400 µL
MEK1 (MAP2K1) pSer218/221 Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
