Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS25 Peptide - C-terminal region

MRPS25 Peptide - C-terminal region

Product Specifications

UniProt

E7EPW2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPS25 Rabbit Polyclonal Antibody (orb587546) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPB1 (Ab-82) Antibody
A52895-100UL 100 µL

HSPB1 (Ab-82) Antibody

Sign In for Pricing
View Details
YPEL3 AAV Vector (Human) (CMV)
50626102 1 µg

YPEL3 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
NAAA, CT (NAAA, ASAHL, PLT, N-acylethanolamine-hydrolyzing acid amidase, Acid ceramidase-like protein, N-acylsphingosine amidohydrolase-like) (FITC)
MBS6323630-01 0.2 mL

NAAA, CT (NAAA, ASAHL, PLT, N-acylethanolamine-hydrolyzing acid amidase, Acid ceramidase-like protein, N-acylsphingosine amidohydrolase-like) (FITC)

Sign In for Pricing
View Details
NAAA, CT (NAAA, ASAHL, PLT, N-acylethanolamine-hydrolyzing acid amidase, Acid ceramidase-like protein, N-acylsphingosine amidohydrolase-like) (FITC)
MBS6323630-02 5x 0.2 mL

NAAA, CT (NAAA, ASAHL, PLT, N-acylethanolamine-hydrolyzing acid amidase, Acid ceramidase-like protein, N-acylsphingosine amidohydrolase-like) (FITC)

Sign In for Pricing
View Details
PPM2C Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
37391061 1.0 µg DNA

PPM2C Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Lentiviral human PSMG4 shRNA (UAS) - Lentiviral human PSMG4 shRNA (UAS) (25)
GTR15118169 1 Vial

Lentiviral human PSMG4 shRNA (UAS) - Lentiviral human PSMG4 shRNA (UAS) (25)

Sign In for Pricing
View Details