Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GBP5 Peptide - N-terminal region

GBP5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GBP-5

UniProt

Q96PP8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GBP5 Rabbit Polyclonal Antibody (orb581710) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_443174

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LHNVTELTDLLKARNSPDLDRVEDPADSASFFPDLVWTLRDFCLGLEIDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
BNC740029-100 1x 100 µL

Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF647 conjugate, 0.1mg/mL
BNC470978-500 1x 500 µL

CD7 (T3-3A1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL
BNC741003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL
BNC401037-100 1x 100 µL

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (NAPSA/1865R), CF488A conjugate, 0.1mg/mL
BNC881865-500 1x 500 µL

Napsin A (Lung Adenocarcinoma Marker) (NAPSA/1865R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3 + CC49), CF405S conjugate, 0.1mg/mL
BNC040738-500 1x 500 µL

TAG-72 / CA72.4 (B72.3 + CC49), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details