Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH2D1A Peptide - middle region

SH2D1A Peptide - middle region

Product Specifications

UniProt

O60880

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SH2D1A Rabbit Polyclonal Antibody (orb584656) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LDHA-IN-3
C03335-25mg 25 mg

LDHA-IN-3

Sign In for Pricing
View Details
AAL Toxin TD2
TRC-A104465-25MG 25 mg

AAL Toxin TD2

Sign In for Pricing
View Details
Cicloprolol (hydrochloride)
HY-U00066-01 1 mg

Cicloprolol (hydrochloride)

Sign In for Pricing
View Details
Cicloprolol (hydrochloride)
HY-U00066-02 5 mg

Cicloprolol (hydrochloride)

Sign In for Pricing
View Details
TMM56 Rabbit Polyclonal Antibody
JOT-AP05190-01 20 µL

TMM56 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TMM56 Rabbit Polyclonal Antibody
JOT-AP05190-02 50 μL

TMM56 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details