SH2D1A Peptide - middle region
SH2D1A Peptide - middle region
Product Specifications
UniProt
O60880
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SH2D1A Rabbit Polyclonal Antibody (orb584656) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15376169 1 Vial
Lentiviral human RRP1B sgRNA gene knockout kit - Lentiviral human RRP1B sgRNA gene knockout kit (plasmid)
Sign In for Pricing
View Details 
K0643806 1.0 µg DNA
DYNLL1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
Sign In for Pricing
View Details 