Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UTP4 Peptide - middle region

UTP4 Peptide - middle region

Product Specifications

Product Name Alternative

NAIC, CIRH1A, CIRHIN, TEX292

UniProt

Q969X6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UTP4 Rabbit Polyclonal Antibody (orb584755) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ADVQSIAVADQEDSFVVGTAEGTVFHFQLVPVTSNSSEKQWVRTKPFQHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BLOC1S3 Knockout HGC-27 Polyclonal Cells
ARG29729 1 Million

BLOC1S3 Knockout HGC-27 Polyclonal Cells

Sign In for Pricing
View Details
Mouse Glucocorticoid Receptor Alpha (GR-α) ELISA Kit
JL11259-01 48 Tests

Mouse Glucocorticoid Receptor Alpha (GR-α) ELISA Kit

Sign In for Pricing
View Details
Mouse Glucocorticoid Receptor Alpha (GR-α) ELISA Kit
JL11259-02 96 Tests

Mouse Glucocorticoid Receptor Alpha (GR-α) ELISA Kit

Sign In for Pricing
View Details
Rabbit FST (Follistatin) ELISA Kit
MBS2506853-01 24 Tests

Rabbit FST (Follistatin) ELISA Kit

Sign In for Pricing
View Details
Rabbit FST (Follistatin) ELISA Kit
MBS2506853-02 48 Tests

Rabbit FST (Follistatin) ELISA Kit

Sign In for Pricing
View Details
Rabbit FST (Follistatin) ELISA Kit
MBS2506853-03 96 Tests

Rabbit FST (Follistatin) ELISA Kit

Sign In for Pricing
View Details