UTP4 Peptide - middle region
UTP4 Peptide - middle region
Product Specifications
Product Name Alternative
NAIC, CIRH1A, CIRHIN, TEX292
UniProt
Q969X6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with UTP4 Rabbit Polyclonal Antibody (orb584755) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ADVQSIAVADQEDSFVVGTAEGTVFHFQLVPVTSNSSEKQWVRTKPFQHH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC402303-100 1x 100 µL
Smooth Muscle Myosin Heavy Chain (SM-MHC) (MYH11/2303R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472176-100 1x 100 µL
MMP9 (rMMP9/1769), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
MGB06F2-PA/W 10x 96 Well Plates
Protein A Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Black PS
Sign In for Pricing
View Details 
BNC400949-100 1x 100 µL
Cytokeratin 7/17 (C-46), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
E-EL-M0040-01 24 Tests
Mouse LIF (Leukemia Inhibitory Factor) ELISA Kit
Sign In for Pricing
View Details E-EL-M0040-02 48 Tests
Mouse LIF (Leukemia Inhibitory Factor) ELISA Kit
Sign In for Pricing
View Details