Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDX4 Peptide - N-terminal region

PRDX4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AOE37-2, PRX-4

UniProt

Q13162

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRDX4 Rabbit Polyclonal Antibody (orb585934) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006397

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLEKHO2 (NM_025201) Human Over-expression Lysate
LH12287V 100 µg

PLEKHO2 (NM_025201) Human Over-expression Lysate

Sign In for Pricing
View Details
GRP78/Bip Mouse Monoclonal Antibody
orb526498-01 50 μL

GRP78/Bip Mouse Monoclonal Antibody

Sign In for Pricing
View Details
GRP78/Bip Mouse Monoclonal Antibody
orb526498-02 100 µL

GRP78/Bip Mouse Monoclonal Antibody

Sign In for Pricing
View Details
GRP78/Bip Mouse Monoclonal Antibody
orb526498-03 200 µL

GRP78/Bip Mouse Monoclonal Antibody

Sign In for Pricing
View Details
GRP78/Bip Mouse Monoclonal Antibody
orb526498-04 200 µg

GRP78/Bip Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Clmn shRNA (UAS) - Lentiviral mouse Clmn shRNA (UAS, RFP) (100)
GTR15210816 1 Vial

Lentiviral mouse Clmn shRNA (UAS) - Lentiviral mouse Clmn shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details