Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDX4 Peptide - N-terminal region

PRDX4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AOE37-2, PRX-4

UniProt

Q13162

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRDX4 Rabbit Polyclonal Antibody (orb585934) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006397

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Native Porcine Alkaline Phosphatase
NATE-0059 1 KU

Native Porcine Alkaline Phosphatase

Sign In for Pricing
View Details
PIRC56 Protein Lysate (Human) with C-Ha Tag
36793031 100 µg

PIRC56 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Anti-Drosophila melanogaster (Fruit fly) Appl Antibody Fluoro550 Conjugated
DZ41645-Fluoro550 200 µL/Vial

Anti-Drosophila melanogaster (Fruit fly) Appl Antibody Fluoro550 Conjugated

Sign In for Pricing
View Details
Recombinant Human SHISAL2B Protein, His (Fc)-Avi-tagged
SHISAL2B-2005H 50 µg

Recombinant Human SHISAL2B Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
ARHGDIA Antibody
A23777-100UG 100 µg

ARHGDIA Antibody

Sign In for Pricing
View Details
Recombinant Mouse CCL24
PEM0254-01 10 µg

Recombinant Mouse CCL24

Sign In for Pricing
View Details