Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANGPTL1 Peptide - C-terminal region

ANGPTL1 Peptide - C-terminal region

Product Specifications

UniProt

E7EW04

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANGPTL1 Rabbit Polyclonal Antibody (orb586010) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PDLATSPTKSPFKIPPVTFINEGPFKDCQQAKEAGHSVNGIFWAEYRGGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 Antibody [F10-89-4] (FITC)
99-534 100 Tests

CD45 Antibody [F10-89-4] (FITC)

Sign In for Pricing
View Details
MC4R Antibody
24906 100 µL

MC4R Antibody

Sign In for Pricing
View Details
MED29 (NM_017592) Human Recombinant Protein
TP316296 20 µg

MED29 (NM_017592) Human Recombinant Protein

Sign In for Pricing
View Details
Human Recombinant VEGF121 Protein (Sf9), biologically active
VEGF24-R-10 10 µg

Human Recombinant VEGF121 Protein (Sf9), biologically active

Sign In for Pricing
View Details
ACC alpha (pS80) Blocking Peptide
MBS8244131-01 1 mg

ACC alpha (pS80) Blocking Peptide

Sign In for Pricing
View Details
ACC alpha (pS80) Blocking Peptide
MBS8244131-02 5 mg

ACC alpha (pS80) Blocking Peptide

Sign In for Pricing
View Details