Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANGPTL1 Peptide - C-terminal region

ANGPTL1 Peptide - C-terminal region

Product Specifications

UniProt

E7EW04

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANGPTL1 Rabbit Polyclonal Antibody (orb586010) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PDLATSPTKSPFKIPPVTFINEGPFKDCQQAKEAGHSVNGIFWAEYRGGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ClearBand 1M Tris, pH 8
T810 1 L

ClearBand 1M Tris, pH 8

Sign In for Pricing
View Details
Olfr299-set siRNA/shRNA/RNAi Lentivector (Mouse)
33047094 4x 500 ng

Olfr299-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
TRAPPC6B Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
47532064 1.0 µg DNA

TRAPPC6B Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
COX6B2 discontinued
387767-01 20 µL

COX6B2 discontinued

Sign In for Pricing
View Details
COX6B2 discontinued
387767-02 200 µL

COX6B2 discontinued

Sign In for Pricing
View Details
SERPIND1 Rabbit Polyclonal Antibody (FITC)
orb2123898 100 µL

SERPIND1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details