Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LGI4 Peptide - C-terminal region

LGI4 Peptide - C-terminal region

Product Specifications

UniProt

K7ENQ0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LGI4 Rabbit Polyclonal Antibody (orb586197) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGRFERRTDIPEAEDVYATRHFQAGGDVFLCLTRYIGDSMVRLGLGAGGW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS646256 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
(+)-Noradrenaline-d5 Bitartrate
TRC-N661028-2.5MG 2.5 mg

(+)-Noradrenaline-d5 Bitartrate

Sign In for Pricing
View Details
TP53TG3B (NM_001099687) Human Over-expression Lysate
LC420498 20 µg

TP53TG3B (NM_001099687) Human Over-expression Lysate

Sign In for Pricing
View Details
Human PCCA activation kit by CRISPRa
GA103406 1 Kit

Human PCCA activation kit by CRISPRa

Sign In for Pricing
View Details
Rat SDF-1α (Stromal Cell Derived Factor 1α) CLIA Kit
E-CL-R0751-01 24 Tests

Rat SDF-1α (Stromal Cell Derived Factor 1α) CLIA Kit

Sign In for Pricing
View Details
Rat SDF-1α (Stromal Cell Derived Factor 1α) CLIA Kit
E-CL-R0751-02 48 Tests

Rat SDF-1α (Stromal Cell Derived Factor 1α) CLIA Kit

Sign In for Pricing
View Details